Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein

PNKD protein,

Recombinant protein of human paroxysmal nonkinesigenic dyskinesia (PNKD), transcript variant 1

Product Info Summary

SKU: PROTQ8N490
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein

View all PNKD recombinant proteins

SKU/Catalog Number

PROTQ8N490

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human paroxysmal nonkinesigenic dyskinesia (PNKD), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8N490)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.9 kDa

Amino Acid Sequence

MAAVVAATALKSRGARNARVLRGILAGATANKVSHNRTRALQSHSSSEGKEEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAQLAVAVDPSDPRAVQASIEKEGVTLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGNAETMLSSLDTVLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKGTCPSTLGEERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRRLKDMHKSK

Validation Images & Assay Conditions

Gene/Protein Information For PNKD (Source: Uniprot.org, NCBI)

Gene Name

PNKD

Full Name

Probable hydrolase PNKD

Weight

38.9 kDa

Superfamily

metallo-beta-lactamase superfamily

Alternative Names

BRP17FKSG19; DKFZp564N1362; DYT8paroxysmal nonkinesiogenic dyskinesia; FPD1brain protein 17; KIAA1184Myofibrillogenesis regulator 1; KIPP1184probable hydrolase PNKD; MGC31943; MR1Paroxysmal nonkinesiogenic dyskinesia protein; MR-1Trans-activated by hepatitis C virus core protein 2; paroxysmal nonkinesigenic dyskinesia; PDCEC 3.-; TAHCCP2PKND1 PNKD BRP17, DYT8, FKSG19, FPD1, KIPP1184, MR-1, MR-1S, MR1, PDC, PKND11, R1, TAHCCP2, PNKD PNKD metallo-beta-lactamase domain containing probable hydrolase PNKD|PNKD, MBL domain containing|brain protein 17|myofibrillogenesis regulator 1|trans-activated by hepatitis C virus core protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PNKD, check out the PNKD Infographic

PNKD infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PNKD: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8N490

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Probable hydrolase PNKD (PNKD) (NM_015488) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8N490
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.