PRMT2 (NM_206962) Human Recombinant Protein

PRMT2 protein,

Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 1

Product Info Summary

SKU: PROTP55345
Size: 20 µg
Source: HEK293T

Product Name

PRMT2 (NM_206962) Human Recombinant Protein

View all PRMT2 recombinant proteins

SKU/Catalog Number

PROTP55345

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PRMT2 (NM_206962) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55345)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

48.9 kDa

Amino Acid Sequence

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

Validation Images & Assay Conditions

Gene/Protein Information For PRMT2 (Source: Uniprot.org, NCBI)

Gene Name

PRMT2

Full Name

Protein arginine N-methyltransferase 2

Weight

48.9 kDa

Superfamily

class I-like SAM-binding methyltransferase superfamily

Alternative Names

EC 2.1.1.-; EC 2.1.1.125; Histone-arginine N-methyltransferase PRMT2; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1; HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae); HMT1 hnRNP methyltransferase-like 1; HMT1; HRMT1L1PRMT2 beta; MGC111373; PRMT2 alpha; PRMT2 gamma; protein arginine methyltransferase 2; protein arginine N-methyltransferase 2 PRMT2 HRMT1L1 protein arginine methyltransferase 2 protein arginine N-methyltransferase 2|HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1|HMT1 hnRNP methyltransferase-like 1|PRMT2 alpha|PRMT2 beta|PRMT2 gamma|histone-arginine N-methyltransferase PRMT2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRMT2, check out the PRMT2 Infographic

PRMT2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRMT2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55345

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PRMT2 (NM_206962) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PRMT2 (NM_206962) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PRMT2 (NM_206962) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55345
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.