POLR1H (NM_170783) Human Recombinant Protein

ZNDR1 protein,

Product Info Summary

SKU: PROTQ9P1U0
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

POLR1H (NM_170783) Human Recombinant Protein

View all ZNDR1 recombinant proteins

SKU/Catalog Number

PROTQ9P1U0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human zinc ribbon domain containing 1 (ZNRD1), transcript variant a

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

POLR1H (NM_170783) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9P1U0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.7 kDa

Amino Acid Sequence

MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

Validation Images & Assay Conditions

Gene/Protein Information For ZNRD1 (Source: Uniprot.org, NCBI)

Gene Name

ZNRD1

Full Name

DNA-directed RNA polymerase I subunit RPA12

Weight

13.7 kDa

Superfamily

archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family

Alternative Names

DNA-directed RNA polymerase I subunit RPA12; HTEX-6; hZR14; MGC13376; RNA polymerase I small specific subunit Rpa12; Rpa12; tctex-6; TEX6; transcription-associated zinc ribbon protein; zinc ribbon domain containing 1; zinc ribbon domain containing, 1; Zinc ribbon domain-containing protein 1 POLR1H A12.2, HTEX-6, HTEX6, Rpa12, TCTEX6, TEX6, ZNRD1, ZR14, hZR14, tctex-6 RNA polymerase I subunit H DNA-directed RNA polymerase I subunit RPA12|DNA-directed RNA polymerase I subunit H|RNA polymerase I small specific subunit Rpa12|transcription-associated zinc ribbon protein|zinc ribbon domain containing 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ZNRD1, check out the ZNRD1 Infographic

ZNRD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ZNRD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9P1U0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used POLR1H (NM_170783) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For POLR1H (NM_170783) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for POLR1H (NM_170783) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9P1U0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.