PMP2 (NM_002677) Human Recombinant Protein

PMP2 protein,

Product Info Summary

SKU: PROTP02689
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PMP2 (NM_002677) Human Recombinant Protein

View all PMP2 recombinant proteins

SKU/Catalog Number

PROTP02689

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peripheral myelin protein 2 (PMP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PMP2 (NM_002677) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP02689)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.7 kDa

Amino Acid Sequence

MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV

Validation Images & Assay Conditions

Gene/Protein Information For PMP2 (Source: Uniprot.org, NCBI)

Gene Name

PMP2

Full Name

Myelin P2 protein

Weight

14.7 kDa

Superfamily

calycin superfamily

Alternative Names

Myelin P2 protein PMP2 CMT1G, FABP8, M-FABP, MP2, P2 peripheral myelin protein 2 myelin P2 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PMP2, check out the PMP2 Infographic

PMP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PMP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP02689

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PMP2 (NM_002677) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PMP2 (NM_002677) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PMP2 (NM_002677) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP02689
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product