plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein

PLPPR1 protein,

Recombinant protein of human plasticity related gene 3 (PRG-3), transcript variant 1

Product Info Summary

SKU: PROTQ8TBJ4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein

View all PLPPR1 recombinant proteins

SKU/Catalog Number

PROTQ8TBJ4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human plasticity related gene 3 (PRG-3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TBJ4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.6 kDa

Amino Acid Sequence

MAVGNNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFITPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAQEKTILTGECCYLNPLLRRIIRFTGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCKPNYTSADCQAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGTLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSPSKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT

Validation Images & Assay Conditions

Gene/Protein Information For PLPPR1 (Source: Uniprot.org, NCBI)

Gene Name

PLPPR1

Full Name

Phospholipid phosphatase-related protein type 1

Weight

35.6 kDa

Superfamily

PA-phosphatase related phosphoesterase family

Alternative Names

Phospholipid phosphatase-related protein type 1 PLPPR1 LPPR1, PRG-3 phospholipid phosphatase related 1 phospholipid phosphatase-related protein type 1|lipid phosphate phosphatase-related protein type 1|plasticity related gene 3|plasticity-related gene 3 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PLPPR1, check out the PLPPR1 Infographic

PLPPR1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PLPPR1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TBJ4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for plasticity related gene 3 (PLPPR1) (NM_207299) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TBJ4
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.