PIGX (NM_001166304) Human Recombinant Protein

PIGX protein,

Purified recombinant protein of Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class X (PIGX), transcript variant 1.

Product Info Summary

SKU: PROTQ8TBF5
Size: 20 µg
Source: HEK293T

Product Name

PIGX (NM_001166304) Human Recombinant Protein

View all PIGX recombinant proteins

SKU/Catalog Number

PROTQ8TBF5

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens phosphatidylinositol glycan anchor biosynthesis, class X (PIGX), transcript variant 1.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PIGX (NM_001166304) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TBF5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.9 kDa

Amino Acid Sequence

LDPVPRRSAAAIALAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQAGSRRMIRFRFDSFDKTIEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL

Validation Images & Assay Conditions

Gene/Protein Information For PIGX (Source: Uniprot.org, NCBI)

Gene Name

PIGX

Full Name

Phosphatidylinositol-glycan biosynthesis class X protein

Weight

28.9 kDa

Superfamily

PIGX family

Alternative Names

Phosphatidylinositol-glycan biosynthesis class X protein PIGX PIG-X phosphatidylinositol glycan anchor biosynthesis class X phosphatidylinositol-glycan biosynthesis class X protein|GPI-mannosyltransferase subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PIGX, check out the PIGX Infographic

PIGX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PIGX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TBF5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PIGX (NM_001166304) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PIGX (NM_001166304) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PIGX (NM_001166304) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TBF5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product