PEX16 (NM_004813) Human Recombinant Protein

PEX16 protein,

Recombinant protein of human peroxisomal biogenesis factor 16 (PEX16), transcript variant 1

Product Info Summary

SKU: PROTQ9Y5Y5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PEX16 (NM_004813) Human Recombinant Protein

View all PEX16 recombinant proteins

SKU/Catalog Number

PROTQ9Y5Y5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peroxisomal biogenesis factor 16 (PEX16), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PEX16 (NM_004813) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y5Y5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.5 kDa

Amino Acid Sequence

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAKAVLRMLLLLWFKAGLQTSPPIVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATPTPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTILLLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG

Validation Images & Assay Conditions

Gene/Protein Information For PEX16 (Source: Uniprot.org, NCBI)

Gene Name

PEX16

Full Name

Peroxisomal membrane protein PEX16

Weight

38.5 kDa

Superfamily

peroxin-16 family

Alternative Names

peroxin-16; peroxisomal biogenesis factor 16peroxin 16; peroxisomal membrane protein PEX16; peroxisome biogenesis factor 16 PEX16 PBD8A, PBD8B peroxisomal biogenesis factor 16 peroxisomal biogenesis factor 16|peroxin 16|peroxisomal membrane protein PEX16|peroxisome biogenesis factor 16

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PEX16, check out the PEX16 Infographic

PEX16 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PEX16: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y5Y5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PEX16 (NM_004813) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PEX16 (NM_004813) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PEX16 (NM_004813) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y5Y5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product