PEX11C (PEX11G) (NM_080662) Human Recombinant Protein

Pex11g protein,

Recombinant protein of human peroxisomal biogenesis factor 11 gamma (PEX11G)

Product Info Summary

SKU: PROTQ96HA9
Size: 20 µg
Source: HEK293T

Product Name

PEX11C (PEX11G) (NM_080662) Human Recombinant Protein

View all Pex11g recombinant proteins

SKU/Catalog Number

PROTQ96HA9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peroxisomal biogenesis factor 11 gamma (PEX11G)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PEX11C (PEX11G) (NM_080662) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96HA9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26.5 kDa

Amino Acid Sequence

MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYTKQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLGVARSLWMLLKLRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSMYQAARAGGQAEATTP

Validation Images & Assay Conditions

Gene/Protein Information For PEX11G (Source: Uniprot.org, NCBI)

Gene Name

PEX11G

Full Name

Peroxisomal membrane protein 11C

Weight

26.5 kDa

Superfamily

peroxin-11 family

Alternative Names

MGC4281; peroxin Pex11p gamma; peroxin-11C; peroxisomal biogenesis factor 11 gamma; Peroxisomal biogenesis factor 11C; peroxisomal biogenesis factor 11G; peroxisomal membrane protein 11C; PEX11C; PEX11-gamma; Protein PEX11 homolog gamma

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PEX11G, check out the PEX11G Infographic

PEX11G infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PEX11G: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96HA9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PEX11C (PEX11G) (NM_080662) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PEX11C (PEX11G) (NM_080662) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PEX11C (PEX11G) (NM_080662) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96HA9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.