PDHX (NM_003477) Human Recombinant Protein

PDHX protein,

Product Info Summary

SKU: PROTO00330
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PDHX (NM_003477) Human Recombinant Protein

View all PDHX recombinant proteins

SKU/Catalog Number

PROTO00330

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pyruvate dehydrogenase complex, component X (PDHX), nuclear gene encoding mitochondrial protein, transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDHX (NM_003477) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00330)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

53.9 kDa

Amino Acid Sequence

MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA

Validation Images & Assay Conditions

Gene/Protein Information For PDHX (Source: Uniprot.org, NCBI)

Gene Name

PDHX

Full Name

Pyruvate dehydrogenase protein X component, mitochondrial

Weight

53.9 kDa

Superfamily

2-oxoacid dehydrogenase family

Alternative Names

Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenasecomplex; DLDBP; E3-binding protein; E3BP; E3BP1; E3BPpyruvate dehydrogenase complex, E3-binding protein subunit; OPDX; PDHX; PDX1; PDX1Lipoyl-containing pyruvate dehydrogenase complex component X; proX; proXpyruvate dehydrogenase complex, lipoyl-containing component X; pyruvate dehydrogenase complex, component X; pyruvate dehydrogenase protein X component, mitochondrial PDHX DLDBP, E3BP, OPDXD, PDX1, proX, PDHX pyruvate dehydrogenase complex component X pyruvate dehydrogenase protein X component, mitochondrial|dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex|lipoyl-containing pyruvate dehydrogenase complex component X|pyruvate dehydrogenase complex, E3-binding protein subunit|pyruvate dehydrogenase complex, lipoyl-containing component X

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDHX, check out the PDHX Infographic

PDHX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDHX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00330

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDHX (NM_003477) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDHX (NM_003477) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDHX (NM_003477) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00330
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.