PDCL (NM_005388) Human Recombinant Protein

PDCL protein,

Product Info Summary

SKU: PROTQ13371
Size: 20 µg
Source: HEK293T

Product Name

PDCL (NM_005388) Human Recombinant Protein

View all PDCL recombinant proteins

SKU/Catalog Number

PROTQ13371

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human phosducin-like (PDCL)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDCL (NM_005388) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13371)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.1 kDa

Amino Acid Sequence

MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEID

Validation Images & Assay Conditions

Gene/Protein Information For PDCL (Source: Uniprot.org, NCBI)

Gene Name

PDCL

Full Name

Phosducin-like protein

Weight

34.1 kDa

Superfamily

phosducin family

Alternative Names

DKFZp564M1863; PhLP; phosducin-like protein; phosducin-like PDCL PhLP phosducin like phosducin-like protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDCL, check out the PDCL Infographic

PDCL infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDCL: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13371

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDCL (NM_005388) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDCL (NM_005388) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDCL (NM_005388) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13371
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product