PDCD5 (NM_004708) Human Recombinant Protein

PDCD5 protein,

Product Info Summary

SKU: PROTO14737
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PDCD5 (NM_004708) Human Recombinant Protein

View all PDCD5 recombinant proteins

SKU/Catalog Number

PROTO14737

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human programmed cell death 5 (PDCD5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDCD5 (NM_004708) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO14737)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14.1 kDa

Amino Acid Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Validation Images & Assay Conditions

Gene/Protein Information For PDCD5 (Source: Uniprot.org, NCBI)

Gene Name

PDCD5

Full Name

Programmed cell death protein 5

Weight

14.1 kDa

Superfamily

PDCD5 family

Alternative Names

FLJ42784; MGC9294; PD5; PDCD5; programmed cell death 5; programmed cell death protein 5; Protein TFAR19; TF-1 cell apoptosis-related protein 19; TFAR19 novel apoptosis-related; TFAR19; TFAR19TF1 cell apoptosis-related gene 19 PDCD5 TFAR19 programmed cell death 5 programmed cell death protein 5|TF-1 cell apoptosis-related protein 19|TF1 cell apoptosis-related gene 19|TFAR19 novel apoptosis-related

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDCD5, check out the PDCD5 Infographic

PDCD5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDCD5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO14737

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDCD5 (NM_004708) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDCD5 (NM_004708) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDCD5 (NM_004708) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO14737
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product