PCP4 (NM_006198) Human Recombinant Protein

PCP4 protein,

Recombinant protein of human Purkinje cell protein 4 (PCP4)

Product Info Summary

SKU: PROTP48539
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PCP4 (NM_006198) Human Recombinant Protein

View all PCP4 recombinant proteins

SKU/Catalog Number

PROTP48539

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Purkinje cell protein 4 (PCP4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PCP4 (NM_006198) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48539)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

6.6 kDa

Amino Acid Sequence

MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Validation Images & Assay Conditions

Gene/Protein Information For PCP4 (Source: Uniprot.org, NCBI)

Gene Name

PCP4

Full Name

Calmodulin regulator protein PCP4

Weight

6.6 kDa

Superfamily

PCP4 family

Alternative Names

brain specific polypeptide PEP19, 10Brain-specific antigen PCP-4; Brain-specific polypeptide PEP-19; PEP19; PEP-19; Purkinje cell protein 4 PCP4 PEP-19 Purkinje cell protein 4 calmodulin regulator protein PCP4|brain specific polypeptide PEP19|brain-specific PCP-4|brain-specific polypeptide PEP-19

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PCP4, check out the PCP4 Infographic

PCP4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PCP4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP48539

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PCP4 (NM_006198) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PCP4 (NM_006198) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PCP4 (NM_006198) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP48539
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product