PBK (NM_018492) Human Recombinant Protein

Pbk protein,

Product Info Summary

SKU: PROTQ96KB5
Size: 20 µg
Source: HEK293T

Product Name

PBK (NM_018492) Human Recombinant Protein

View all Pbk recombinant proteins

SKU/Catalog Number

PROTQ96KB5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PDZ binding kinase (PBK)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PBK (NM_018492) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96KB5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.9 kDa

Amino Acid Sequence

MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

Validation Images & Assay Conditions

Gene/Protein Information For PBK (Source: Uniprot.org, NCBI)

Gene Name

PBK

Full Name

Lymphokine-activated killer T-cell-originated protein kinase

Weight

35.9 kDa

Superfamily

protein kinase superfamily

Alternative Names

Cancer/testis antigen 84; CT84MAPKK-like protein kinase; EC 2.7.12.2; FLJ14385; Nori-3PDZ-binding kinase; PDZ binding kinase; serine/threonine protein kinase; Spermatogenesis-related protein kinase; SPKT-LAK cell-originated protein kinase; TOPKlymphokine-activated killer T-cell-originated protein kinase Pbk|2810434B10Rik, AW538537, D14Ertd732, D14Ertd732e, TO, TOPK|PDZ binding kinase|lymphokine-activated killer T-cell-originated protein kinase|MAPKK-like protein kinase|T-LAK cell-originated protein kinase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PBK, check out the PBK Infographic

PBK infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PBK: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96KB5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PBK (NM_018492) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PBK (NM_018492) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PBK (NM_018492) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96KB5
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.