Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein

Pancreatic Polypeptide/PP protein,

Purified recombinant protein of Homo sapiens pancreatic polypeptide (PPY)

Product Info Summary

SKU: PROTP01298
Size: 20 µg
Source: HEK293T

Product Name

Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein

View all Pancreatic Polypeptide/PP recombinant proteins

SKU/Catalog Number

PROTP01298

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens pancreatic polypeptide (PPY)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01298)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.5 kDa

Amino Acid Sequence

MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL

Validation Images & Assay Conditions

Gene/Protein Information For PPY (Source: Uniprot.org, NCBI)

Gene Name

PPY

Full Name

Pancreatic prohormone

Weight

7.5 kDa

Superfamily

NPY family

Alternative Names

INN; Obinepitide; pancreatic polypeptide (ppy); pancreatic polypeptide PNPPP; pancreatic polypeptide Y; Pancreatic Polypeptide; pancreatic prohormone; PNP; PP; PPY PPY PNP, PP pancreatic polypeptide pancreatic prohormone|pancreatic polypeptide Y|prepro-PP (prepropancreatic polypeptide)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPY, check out the PPY Infographic

PPY infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPY: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01298

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01298
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.