PAFAH1B2 (NM_002572) Human Recombinant Protein

PAFAH1B2 protein,

Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa (PAFAH1B2)

Product Info Summary

SKU: PROTP68402
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PAFAH1B2 (NM_002572) Human Recombinant Protein

View all PAFAH1B2 recombinant proteins

SKU/Catalog Number

PROTP68402

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa (PAFAH1B2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAFAH1B2 (NM_002572) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP68402)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.4 kDa

Amino Acid Sequence

MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Validation Images & Assay Conditions

Gene/Protein Information For PAFAH1B2 (Source: Uniprot.org, NCBI)

Gene Name

PAFAH1B2

Full Name

Platelet-activating factor acetylhydrolase IB subunit beta

Weight

25.4 kDa

Superfamily

GDSL' lipolytic enzyme family

Alternative Names

EC 3.1.1.47; intracellular platelet-activating factor acetylhydrolase alpha 2 subunit; PAF acetylhydrolase 30 kDa subunit; PAF-AH 30 kDa subunit; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH1b alpha 2 subunit; PAFAHB; platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa); platelet-activating factor acetylhydrolase IB subunit beta; platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa; platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa) PAFAH1B2 HEL-S-303 platelet activating factor acetylhydrolase 1b catalytic subunit 2 platelet-activating factor acetylhydrolase IB subunit alpha2|PAF acetylhydrolase 30 kDa subunit|PAF-AH 30 kDa subunit|PAF-AH subunit beta|PAF-AH1b alpha 2 subunit|PAFAH subunit beta|epididymis secretory protein Li 303|epididymis secretory sperm binding protein|intracellular platelet-activating factor acetylhydrolase alpha 2 subunit|platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)|platelet-activating factor acetylhydrolase IB subunit beta

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAFAH1B2, check out the PAFAH1B2 Infographic

PAFAH1B2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAFAH1B2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP68402

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAFAH1B2 (NM_002572) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAFAH1B2 (NM_002572) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAFAH1B2 (NM_002572) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP68402
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.