OPCML (NM_001012393) Human Recombinant Protein

OBCAM/OPCML protein,

Recombinant protein of human opioid binding protein/cell adhesion molecule-like (OPCML), transcript variant 2

Product Info Summary

SKU: PROTQ14982
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

OPCML (NM_001012393) Human Recombinant Protein

View all OBCAM/OPCML recombinant proteins

SKU/Catalog Number

PROTQ14982

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human opioid binding protein/cell adhesion molecule-like (OPCML), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

OPCML (NM_001012393) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14982)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.7 kDa

Amino Acid Sequence

MYHPAYWVVFSATTALLFIPGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF

Validation Images & Assay Conditions

Gene/Protein Information For OPCML (Source: Uniprot.org, NCBI)

Gene Name

OPCML

Full Name

Opioid-binding protein/cell adhesion molecule

Weight

34.7 kDa

Superfamily

immunoglobulin superfamily

Alternative Names

IgLON family member 1; IGLON1opioid-binding protein/cell adhesion molecule-like; OBCAM; OBCAMopiate binding-cell adhesion molecule; OPCM; OPCML; opioid binding protein/cell adhesion molecule-like preprotein; opioid binding protein/cell adhesion molecule-like; Opioid-binding cell adhesion molecule; opioid-binding protein/cell adhesion molecule OPCML IGLON1, OBCAM, OPCM opioid binding protein/cell adhesion molecule like opioid-binding protein/cell adhesion molecule|IgLON family member 1|opioid binding protein/cell adhesion molecule-like preprotein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on OPCML, check out the OPCML Infographic

OPCML infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OPCML: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14982

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used OPCML (NM_001012393) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For OPCML (NM_001012393) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for OPCML (NM_001012393) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14982
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.