NUP43 (NM_198887) Human Recombinant Protein

Nup43 protein,

Recombinant protein of human nucleoporin 43kDa (NUP43), transcript variant 1

Product Info Summary

SKU: PROTQ8NFH3
Size: 20 µg
Source: HEK293T

Product Name

NUP43 (NM_198887) Human Recombinant Protein

View all Nup43 recombinant proteins

SKU/Catalog Number

PROTQ8NFH3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nucleoporin 43kDa (NUP43), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUP43 (NM_198887) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NFH3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42 kDa

Amino Acid Sequence

MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTFLRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDGMLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASTDVPEKSSLFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAIYVTRHLFS

Validation Images & Assay Conditions

Gene/Protein Information For NUP43 (Source: Uniprot.org, NCBI)

Gene Name

NUP43

Full Name

Nucleoporin Nup43

Weight

42 kDa

Alternative Names

bA350J20.1; FLJ13287; nucleoporin 43kDa; nucleoporin Nup43; Nup107-160 subcomplex subunit Nup43; p42

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUP43, check out the NUP43 Infographic

NUP43 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUP43: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NFH3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUP43 (NM_198887) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUP43 (NM_198887) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUP43 (NM_198887) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NFH3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.