NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

S100A7A protein,

Product Info Summary

SKU: PROTQ86SG5
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

View all S100A7A recombinant proteins

SKU/Catalog Number

PROTQ86SG5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S100 calcium binding protein A7A (S100A7A)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NICE2 (S100A7A) (NM_176823) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ86SG5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.1 kDa

Amino Acid Sequence

MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

Validation Images & Assay Conditions

Gene/Protein Information For S100A7A (Source: Uniprot.org, NCBI)

Gene Name

S100A7A

Full Name

Protein S100-A7A

Weight

11.1 kDa

Superfamily

S-100 family

Alternative Names

Protein S100-A7A S100A7A NICE-2, NICE2, S100A15, S100A7L1, S100A7f S100 calcium binding protein A7A protein S100-A7A|S100 calcium-binding protein A15|S100 calcium-binding protein A7-like 1|koebnerisin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on S100A7A, check out the S100A7A Infographic

S100A7A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for S100A7A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used NICE2 (S100A7A) (NM_176823) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ86SG5
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.