NDUFA4 (NM_002489) Human Recombinant Protein

NDUFA4 protein,

Product Info Summary

SKU: PROTO00483
Size: 20 µg
Source: HEK293T

Product Name

NDUFA4 (NM_002489) Human Recombinant Protein

View all NDUFA4 recombinant proteins

SKU/Catalog Number

PROTO00483

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa (NDUFA4), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFA4 (NM_002489) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO00483)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.2 kDa

Amino Acid Sequence

MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Validation Images & Assay Conditions

Gene/Protein Information For NDUFA4 (Source: Uniprot.org, NCBI)

Gene Name

NDUFA4

Full Name

Cytochrome c oxidase subunit NDUFA4

Weight

9.2 kDa

Superfamily

complex IV NDUFA4 subunit family

Alternative Names

Cytochrome c oxidase subunit NDUFA4 NDUFA4 CI-9k, CI-MLRQ, COXFA4, MC4DN21, MLRQ NDUFA4 mitochondrial complex associated cytochrome c oxidase subunit NDUFA4|Complex I 9kDa subunit|NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4|NADH-ubiquinone oxidoreductase MLRQ subunit|complex I-MLRQ|cytochrome c oxidase subunit FA4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFA4, check out the NDUFA4 Infographic

NDUFA4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFA4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO00483

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFA4 (NM_002489) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFA4 (NM_002489) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFA4 (NM_002489) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO00483
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product