myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein

Fast skeletal myosin light chain 1 protein,

Product Info Summary

SKU: PROTP05976
Size: 20 µg
Source: HEK293T

Product Name

myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein

View all Fast skeletal myosin light chain 1 recombinant proteins

SKU/Catalog Number

PROTP05976

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human myosin, light chain 1, alkali; skeletal, fast (MYL1), transcript variant 3f

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05976)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.5 kDa

Amino Acid Sequence

MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI

Validation Images & Assay Conditions

Gene/Protein Information For MYL1 (Source: Uniprot.org, NCBI)

Gene Name

MYL1

Full Name

Myosin light chain 1/3, skeletal muscle isoform

Weight

16.5 kDa

Alternative Names

A1 catalytic; A2 catalytic; MLC1/MLC3; MLC1F; MLC1F/MLC3F; MLC3F; myosin light chain 1/3, skeletal muscle isoform; Myosin light chain A1/A2; Myosin light chain alkali 1/2; myosin, light chain 1, alkali; skeletal, fast; myosin, light polypeptide 1, alkali; skeletal, fast MYL1 MLC1F, MLC3F, MYOFTA myosin light chain 1 myosin light chain 1/3, skeletal muscle isoform|A1 catalytic|A2 catalytic|MLC1/MLC3|MLC1F/MLC3F|myosin light chain A1/A2|myosin light chain alkali 1/2|myosin, light chain 1, alkali; skeletal, fast|myosin, light polypeptide 1, alkali; skeletal, fast

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MYL1, check out the MYL1 Infographic

MYL1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MYL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05976

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for myosin light chain 1 (MYL1) (NM_079422) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05976
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product