Muted (BLOC1S5) (NM_201280) Human Recombinant Protein

MUTED protein,

Product Info Summary

SKU: PROTQ8TDH9
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Muted (BLOC1S5) (NM_201280) Human Recombinant Protein

View all MUTED recombinant proteins

SKU/Catalog Number

PROTQ8TDH9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human muted homolog (mouse) (MUTED)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Muted (BLOC1S5) (NM_201280) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8TDH9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.4 kDa

Amino Acid Sequence

MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF

Validation Images & Assay Conditions

Gene/Protein Information For BLOC1S5 (Source: Uniprot.org, NCBI)

Gene Name

BLOC1S5

Full Name

Biogenesis of lysosome-related organelles complex 1 subunit 5

Weight

21.4 kDa

Superfamily

BLOC1S5 family

Alternative Names

DKFZp686E2287; FLJ18427; MUdJ303A1.3; muted homolog (mouse); protein Muted homolog Bloc1s5|1810074A19Rik, Muted, mu|biogenesis of lysosomal organelles complex-1, subunit 5, muted|biogenesis of lysosome-related organelles complex 1 subunit 5|BLOC-1 subunit 5|biogenesis of organelles complex-1, subunit 5, muted|protein Muted homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BLOC1S5, check out the BLOC1S5 Infographic

BLOC1S5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BLOC1S5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8TDH9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Muted (BLOC1S5) (NM_201280) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Muted (BLOC1S5) (NM_201280) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Muted (BLOC1S5) (NM_201280) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8TDH9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.