MSRB3 (NM_001031679) Human Recombinant Protein

MSRB3 protein,

Product Info Summary

SKU: PROTQ8IXL7
Size: 20 µg
Source: HEK293T

Product Name

MSRB3 (NM_001031679) Human Recombinant Protein

View all MSRB3 recombinant proteins

SKU/Catalog Number

PROTQ8IXL7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methionine sulfoxide reductase B3 (MSRB3), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MSRB3 (NM_001031679) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IXL7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.8 kDa

Amino Acid Sequence

MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

Validation Images & Assay Conditions

Gene/Protein Information For MSRB3 (Source: Uniprot.org, NCBI)

Gene Name

MSRB3

Full Name

Methionine-R-sulfoxide reductase B3

Weight

19.8 kDa

Superfamily

MsrB Met sulfoxide reductase family

Alternative Names

DFNB74; DKFZp686C1178; EC 1.8.4.-; EC 1.8.4.12; FLJ36866; methionine sulfoxide reductase B3; methionine-R-sulfoxide reductase B3; methionine-R-sulfoxide reductase B3, mitochondrial; MsrB3 MSRB3 DFNB74 methionine sulfoxide reductase B3 methionine-R-sulfoxide reductase B3|methionine-R-sulfoxide reductase B3, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MSRB3, check out the MSRB3 Infographic

MSRB3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MSRB3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IXL7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MSRB3 (NM_001031679) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MSRB3 (NM_001031679) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MSRB3 (NM_001031679) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IXL7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.