MS4A7 (NM_206939) Human Recombinant Protein

MS4A7 protein,

Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 3

Product Info Summary

SKU: PROTQ9GZW8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MS4A7 (NM_206939) Human Recombinant Protein

View all MS4A7 recombinant proteins

SKU/Catalog Number

PROTQ9GZW8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 7 (MS4A7), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MS4A7 (NM_206939) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9GZW8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

26 kDa

Amino Acid Sequence

MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI

Validation Images & Assay Conditions

Gene/Protein Information For MS4A7 (Source: Uniprot.org, NCBI)

Gene Name

MS4A7

Full Name

Membrane-spanning 4-domains subfamily A member 7

Weight

26 kDa

Superfamily

MS4A family

Alternative Names

4SPAN2; CD20/FC-epsilon-RI-beta family member 4; CD20L4; CD20L4MGC22368; CFFM4; CFFM4CD20 antigen-like 4; CFFMA; Four-span transmembrane protein 2; high affinity immunoglobulin epsilon receptor beta subunit; membrane-spanning 4-domains subfamily A member 7; membrane-spanning 4-domains, subfamily A, member 7,4SPAN2; MS4A7; MS4A8 MS4A7 4SPAN2, CD20L4, CFFM4, MS4A8 membrane spanning 4-domains A7 membrane-spanning 4-domains subfamily A member 7|CD20 antigen-like 4|CD20/Fc-epsilon-RI-beta family member 4|four-span transmembrane protein 2|high affinity immunoglobulin epsilon receptor beta subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MS4A7, check out the MS4A7 Infographic

MS4A7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MS4A7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9GZW8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MS4A7 (NM_206939) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MS4A7 (NM_206939) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MS4A7 (NM_206939) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9GZW8
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.