MRPL54 (NM_172251) Human Recombinant Protein

Mrpl54 protein,

Recombinant protein of human mitochondrial ribosomal protein L54 (MRPL54), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTQ6P161
Size: 20 µg
Source: HEK293T

Product Name

MRPL54 (NM_172251) Human Recombinant Protein

View all Mrpl54 recombinant proteins

SKU/Catalog Number

PROTQ6P161

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial ribosomal protein L54 (MRPL54), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRPL54 (NM_172251) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6P161)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.6 kDa

Amino Acid Sequence

MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL

Validation Images & Assay Conditions

Gene/Protein Information For MRPL54 (Source: Uniprot.org, NCBI)

Gene Name

MRPL54

Full Name

39S ribosomal protein L54, mitochondrial

Weight

15.6 kDa

Alternative Names

L54mt; mitochondrial ribosomal protein L54; MRP-L54,39S ribosomal protein L54, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRPL54, check out the MRPL54 Infographic

MRPL54 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRPL54: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ6P161

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRPL54 (NM_172251) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRPL54 (NM_172251) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRPL54 (NM_172251) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6P161
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product