MRPL53 (NM_053050) Human Recombinant Protein

Mrpl53 protein,

Recombinant protein of human mitochondrial ribosomal protein L53 (MRPL53), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTQ96EL3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MRPL53 (NM_053050) Human Recombinant Protein

View all Mrpl53 recombinant proteins

SKU/Catalog Number

PROTQ96EL3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial ribosomal protein L53 (MRPL53), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MRPL53 (NM_053050) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96EL3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

11.9 kDa

Amino Acid Sequence

MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR

Validation Images & Assay Conditions

Gene/Protein Information For MRPL53 (Source: Uniprot.org, NCBI)

Gene Name

MRPL53

Full Name

39S ribosomal protein L53, mitochondrial

Weight

11.9 kDa

Superfamily

mitochondrion-specific ribosomal protein mL53 family

Alternative Names

39S ribosomal protein L53, mitochondrial

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MRPL53, check out the MRPL53 Infographic

MRPL53 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MRPL53: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96EL3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MRPL53 (NM_053050) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MRPL53 (NM_053050) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MRPL53 (NM_053050) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96EL3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product