Click image to see more details
Product Info Summary
| SKU: | PROTP12025-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant Midkine protein, AF
View all Midkine recombinant proteins
SKU/Catalog Number
PROTP12025-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Midkine, also known as neurite growth-promoting factor 2 (NEGF2) is a member of a small family of secreted Growth Factorss, furthermore high expression in embryo, and limb E14.5. Mouse midkine shares 87% sequence identity with human midkine. Midkine is a 13.5 kDa protein containing 140 amino acids, which promotes angiogenesis, cell growth, migration, and gene expression of different cell types probably via a multiprotein receptor complex consisting of several molecules.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant Midkine protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP12025-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
15.585kDa
Molecular weight
The protein has a calculated MW of 14.02 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse Midkine
Protein Target Info & Infographic
Gene/Protein Information For MDK (Source: Uniprot.org, NCBI)
Gene Name
MDK
Full Name
Midkine
Weight
15.585kDa
Superfamily
pleiotrophin family
Alternative Names
MK, NEGF-2, Mek MDK ARAP, MK, NEGF2 midkine midkine|amphiregulin-associated protein|midgestation and kidney protein|neurite growth-promoting factor 2|neurite outgrowth-promoting factor 2|retinoic acid inducible factor
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MDK, check out the MDK Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MDK: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant Midkine protein, AF (PROTP12025-2)
Hello CJ!
No publications found for PROTP12025-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant Midkine protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant Midkine protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
