Click image to see more details
Product Info Summary
| SKU: | PROTA0A0B4J1G4 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-17D (Interleukin-17D) protein, AF
View all IL-17D recombinant proteins
SKU/Catalog Number
PROTA0A0B4J1G4
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Interleukin 17D (IL-17D) belongs to the IL-17 family of cytokines, predicts a molecular mass of 20 kDa. IL-17 family is closely linked to host defense and immune response, and IL-17D is a novel cytokine in the IL-17 family of cytokines that has not been extensively investigated. It is highly secreted by fibrosarcoma tumor cells; in addition, ectopic expression of IL-17D in tumor cells recruits natural killer cells via the CCL2 production of endothelial cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-17D (Interleukin-17D) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA0A0B4J1G4)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
21.893kDa
Molecular weight
The protein has a calculated MW of 20.74 kDa. The protein migrates about 25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
ALRTGRRPARPRDCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRAADRRFRPPTNLRSVSPWAYRISYDPARFPRYLPEAYCLCRGCLTGLYGEEDFRFRSTPVFSPAVVLRRTAACAGGRSVYAEHYITIPVGCTCVPEPDKSAZDSANSSMDKLLLGPADRPAGR with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-17D
Protein Target Info & Infographic
Gene/Protein Information For Il17d (Source: Uniprot.org, NCBI)
Gene Name
Il17d
Full Name
Interleukin-17D
Weight
21.893kDa
Superfamily
IL-17 family
Alternative Names
AI462269 IL17D IL-17D interleukin 17D interleukin-17D
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on Il17d, check out the Il17d Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for Il17d: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-17D (Interleukin-17D) protein, AF (PROTA0A0B4J1G4)
Hello CJ!
No publications found for PROTA0A0B4J1G4
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-17D (Interleukin-17D) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-17D (Interleukin-17D) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
