Mouse recombinant IL-15 (Interleukin-15) protein, AF

IL-15 protein, Mouse

Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

Product Info Summary

SKU: PROTP48346-4
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant IL-15 (Interleukin-15) protein, AF

View all IL-15 recombinant proteins

SKU/Catalog Number

PROTP48346-4

Size

5ug,20ug,100ug

Tag

His Tag (N-term)

Description

Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant IL-15 (Interleukin-15) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP48346-4)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution of Proleukin buffer, pH 7.5.containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

18.086kDa

Molecular weight

The protein has a calculated MW of 14.2 kDa. The protein migrates as 11-14 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce CTLL-2 cells proliferation. The ED₅₀ for this effect is <10 ng/mL. The specific activity of recombinant mouse IL-15 is approximately >1x 10⁵ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS with polyhistidine tag at the N-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For Il15 (Source: Uniprot.org, NCBI)

Gene Name

Il15

Full Name

Interleukin-15

Weight

18.086kDa

Superfamily

IL-15/IL-21 family

Alternative Names

IL-T IL15 IL-15 interleukin 15 interleukin-15

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Il15, check out the Il15 Infographic

Il15 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Il15: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used Mouse recombinant IL-15 (Interleukin-15) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant IL-15 (Interleukin-15) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant IL-15 (Interleukin-15) protein, AF

Size

Total: $77

SKU:PROTP48346-4

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTP48346-4
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.