Click image to see more details
Product Info Summary
| SKU: | PROTP01575-2 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IFN beta 1a (Interferon beta 1a) protein, AF
View all IFN-beta recombinant proteins
SKU/Catalog Number
PROTP01575-2
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
Interferon Beta 1a (IFN beta 1a) is a leukocyte interferon, which is a variant of Interferon beta. IFN beta 1a is a 17.87 kDa protein containing 161 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IFN beta 1a (Interferon beta 1a) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01575-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
22.294kDa
Molecular weight
The protein has a calculated MW of 20.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to protect HeLa cells infected with encephalomyocarditis (EMC) virus. The ED₅₀ for this effect is <5 pg/mL. The specific activity of recombinant mouse IFN beta 1a is > 1 x 10^9 IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN with polyhistidine tag at the C-terminus
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IFN beta 1a
Protein Target Info & Infographic
Gene/Protein Information For IFNB1 (Source: Uniprot.org, NCBI)
Gene Name
IFNB1
Full Name
Interferon beta
Weight
22.294kDa
Superfamily
alpha/beta interferon family
Alternative Names
IFNB1, Type I Interferon IFNB1 IFB, IFF, IFN-beta, IFNB interferon beta 1 interferon beta|fibroblast interferon|interferon, beta 1, fibroblast|interferon-beta
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IFNB1, check out the IFNB1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IFNB1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IFN beta 1a (Interferon beta 1a) protein, AF (PROTP01575-2)
Hello CJ!
No publications found for PROTP01575-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IFN beta 1a (Interferon beta 1a) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IFN beta 1a (Interferon beta 1a) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
