Click image to see more details
Product Info Summary
| SKU: | PROTP01587-3 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF
View all GM-CSF recombinant proteins
SKU/Catalog Number
PROTP01587-3
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Granulocyte-macrophage colony-stimulating factor (GM-CSF) was first identified as a Growth Factors due to its ability to induce proliferation and differentiation of bone marrow progenitors into granulocytes and macrophages. GM-CSF is produced by multiple cell types including activated T cells, B cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. GM-CSF stimulates stem cells to produce granulocytes and monocytes functions as a cytokine.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01587-3)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
16.295kDa
Molecular weight
The protein has a calculated MW of 15.1 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in FDC-P1 cells. The ED₅₀ for this effect is <50 pg/mL. The specific activity of recombinant mouse GM-CSF is approximately >2 x 10⁷ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse GM-CSF
Protein Target Info & Infographic
Gene/Protein Information For CSF2 (Source: Uniprot.org, NCBI)
Gene Name
CSF2
Full Name
Granulocyte-macrophage colony-stimulating factor
Weight
16.295kDa
Superfamily
GM-CSF family
Alternative Names
colony stimulating factor 2, CSF2, CSF, Csfg, Csfgm, GMCS, GMCSF, Gm-CS, Gm-CSf, MGI-I, MGI-IGM CSF2 CSF, GMCSF colony stimulating factor 2 granulocyte-macrophage colony-stimulating factor|colony stimulating factor 2 (granulocyte-macrophage)|granulocyte macrophage-colony stimulating factor|molgramostim|molgramostin|sargramostim
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CSF2, check out the CSF2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CSF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF (PROTP01587-3)
Hello CJ!
No publications found for PROTP01587-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant GM-CSF (Granulocyte-macrophage colony-stimulating factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
