Click image to see more details
Product Info Summary
| SKU: | PROTO55237 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant CD27L (CD27 ligand) protein, AF
View all CD27 Ligand/TNFSF7/CD70 recombinant proteins
SKU/Catalog Number
PROTO55237
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
CD27L is also named for CD70 which is one member of TNF family. CD27L is expressed on T and B lymphocytes and mature DCs. It binds the CD27, which is on the antigen-presenting cells. CD27L is a 19.2 kDa cytokine with 148 amino acid residues which is a transmembrane glycoprotein. CD27L plays an important role in the regulation of T cell proliferation which is also a good target of cancer immunotherapy.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant CD27L (CD27 ligand) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO55237)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
21.118kDa
Molecular weight
The protein has a calculated MW of 17.25 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <4.5 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse CD27L
Protein Target Info & Infographic
Gene/Protein Information For CD70 (Source: Uniprot.org, NCBI)
Gene Name
CD70
Full Name
CD70 antigen
Weight
21.118kDa
Superfamily
tumor necrosis factor family
Alternative Names
soluble CD27 Ligand, sCD27 Ligand, TNFSF7, CD70, Tnfs, Tnlg8a CD70 CD27-L, CD27L, CD27LG, LPFS3, TNFSF7, TNLG8A CD70 molecule CD70 |CD27 ligand|Ki-24 |surface CD70|tumor necrosis factor ligand 8A|tumor necrosis factor ligand superfamily member 7
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on CD70, check out the CD70 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CD70: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant CD27L (CD27 ligand) protein, AF (PROTO55237)
Hello CJ!
No publications found for PROTO55237
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant CD27L (CD27 ligand) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant CD27L (CD27 ligand) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
