Product Info Summary
SKU: | PROTQ9WU72 |
---|---|
Size: | 5ug,20ug,100ug |
Origin Species: | Mouse |
Source: | Escherichia coli |
Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant BAFF (B-cell activating factor) protein, AF
View all BAFF/BLyS/TNFSF13B recombinant proteins
SKU/Catalog Number
PROTQ9WU72
Size
5ug,20ug,100ug
Tag
His Tag (C-term)
Description
BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant BAFF (B-cell activating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9WU72)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
31.223kDa
Molecular weight
The protein has a calculated MW of 21.56 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to induce proliferation in mouse B cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10⁶ IU/mg.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse BAFF
Protein Target Info & Infographic
Gene/Protein Information For TNFSF13B (Source: Uniprot.org, NCBI)
Gene Name
TNFSF13B
Full Name
Tumor necrosis factor ligand superfamily member 13B
Weight
31.223kDa
Superfamily
tumor necrosis factor family
Alternative Names
tumor necrosis factor (ligand) superfamily, member 13b,Tnfsf13b, BAF, BL, BLyS, D8Ertd387, D8Ertd387e, TAL, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF, zTNF4 TNFSF13B BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, TNLG7A, ZTNF4 TNF superfamily member 13b tumor necrosis factor ligand superfamily member 13B|ApoL related ligand TALL-1|B-cell-activating factor|B-lymphocyte stimulator|Delta4 BAFF|TNF and ApoL-related leukocyte expressed ligand 1|TNF homolog that activates apoptosis|delta BAFF|dendritic cell-derived TNF-like molecule|epididymis secretory sperm binding protein|tumor necrosis factor (ligand) superfamily, member 13b|tumor necrosis factor (ligand) superfamily, member 20|tumor necrosis factor ligand 7A|tumor necrosis factor superfamily member 13b|tumor necrosis factor-like protein ZTNF4
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TNFSF13B, check out the TNFSF13B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TNFSF13B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant BAFF (B-cell activating factor) protein, AF (PROTQ9WU72)
Hello CJ!
No publications found for PROTQ9WU72
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant BAFF (B-cell activating factor) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant BAFF (B-cell activating factor) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question