Mouse recombinant BAFF (B-cell activating factor) protein, AF

BAFF/BLyS/TNFSF13B protein, Mouse

BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.

Product Info Summary

SKU: PROTQ9WU72
Size: 5ug,20ug,100ug
Origin Species: Mouse
Source: Escherichia coli
Application: Cell Culture

Product Name

Mouse recombinant BAFF (B-cell activating factor) protein, AF

View all BAFF/BLyS/TNFSF13B recombinant proteins

SKU/Catalog Number

PROTQ9WU72

Size

5ug,20ug,100ug

Tag

His Tag (C-term)

Description

BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Mouse recombinant BAFF (B-cell activating factor) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9WU72)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

31.223kDa

Molecular weight

The protein has a calculated MW of 21.56 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to induce proliferation in mouse B cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10⁶ IU/mg.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For TNFSF13B (Source: Uniprot.org, NCBI)

Gene Name

TNFSF13B

Full Name

Tumor necrosis factor ligand superfamily member 13B

Weight

31.223kDa

Superfamily

tumor necrosis factor family

Alternative Names

tumor necrosis factor (ligand) superfamily, member 13b,Tnfsf13b, BAF, BL, BLyS, D8Ertd387, D8Ertd387e, TAL, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF, zTNF4 TNFSF13B BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, TNLG7A, ZTNF4 TNF superfamily member 13b tumor necrosis factor ligand superfamily member 13B|ApoL related ligand TALL-1|B-cell-activating factor|B-lymphocyte stimulator|Delta4 BAFF|TNF and ApoL-related leukocyte expressed ligand 1|TNF homolog that activates apoptosis|delta BAFF|dendritic cell-derived TNF-like molecule|epididymis secretory sperm binding protein|tumor necrosis factor (ligand) superfamily, member 13b|tumor necrosis factor (ligand) superfamily, member 20|tumor necrosis factor ligand 7A|tumor necrosis factor superfamily member 13b|tumor necrosis factor-like protein ZTNF4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TNFSF13B, check out the TNFSF13B Infographic

TNFSF13B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TNFSF13B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9WU72

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Mouse recombinant BAFF (B-cell activating factor) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Mouse recombinant BAFF (B-cell activating factor) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Mouse recombinant BAFF (B-cell activating factor) protein, AF

Size

Total: $77

SKU:PROTQ9WU72

Backordered.

Lead time for this item is typically 3-4 weeks

Get A Quote
In stock
Order Product
PROTQ9WU72
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.