MORN4 (NM_178832) Human Recombinant Protein

MORN4 protein,

Recombinant protein of human MORN repeat containing 4 (MORN4), transcript variant 1

Product Info Summary

SKU: PROTQ8NDC4
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MORN4 (NM_178832) Human Recombinant Protein

View all MORN4 recombinant proteins

SKU/Catalog Number

PROTQ8NDC4

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MORN repeat containing 4 (MORN4), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MORN4 (NM_178832) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NDC4)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.1 kDa

Amino Acid Sequence

MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGSRYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA

Validation Images & Assay Conditions

Gene/Protein Information For MORN4 (Source: Uniprot.org, NCBI)

Gene Name

MORN4

Full Name

MORN repeat-containing protein 4

Weight

16.1 kDa

Alternative Names

bA548K23.4; C10orf83; chromosome 10 open reading frame 83; FLJ25925,44050 protein; MORN repeat containing 4; MORN repeat-containing protein 4; Protein 44050; retinophilin MORN4 C10orf83, UTA, bA548K23.4, rtp MORN repeat containing 4 MORN repeat-containing protein 4|44050 protein|protein 44050|retinophilin homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MORN4, check out the MORN4 Infographic

MORN4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MORN4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NDC4

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MORN4 (NM_178832) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MORN4 (NM_178832) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MORN4 (NM_178832) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NDC4
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.