MORN3 (NM_173855) Human Recombinant Protein

Morn3 protein,

Recombinant protein of human MORN repeat containing 3 (MORN3)

Product Info Summary

SKU: PROTQ6PF18
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MORN3 (NM_173855) Human Recombinant Protein

View all Morn3 recombinant proteins

SKU/Catalog Number

PROTQ6PF18

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MORN repeat containing 3 (MORN3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MORN3 (NM_173855) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ6PF18)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27.4 kDa

Amino Acid Sequence

MPVSKCPKKSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWEDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNMAKCGTMIDFGRDEAPEPTQFPIPEVKILDPDGVLAEALAMFRKTEEGD

Validation Images & Assay Conditions

Gene/Protein Information For MORN3 (Source: Uniprot.org, NCBI)

Gene Name

MORN3

Full Name

MORN repeat-containing protein 3

Weight

27.4 kDa

Alternative Names

membrane occupation and recognition nexus repeat containing protein; MGC71497; MORN repeat containing 3; MORN repeat-containing protein 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MORN3, check out the MORN3 Infographic

MORN3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MORN3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used MORN3 (NM_173855) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MORN3 (NM_173855) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MORN3 (NM_173855) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ6PF18
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.