MOCS3 (NM_014484) Human Recombinant Protein

MOCS3 protein,

Recombinant protein of human molybdenum cofactor synthesis 3 (MOCS3)

Product Info Summary

SKU: PROTO95396
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MOCS3 (NM_014484) Human Recombinant Protein

View all MOCS3 recombinant proteins

SKU/Catalog Number

PROTO95396

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human molybdenum cofactor synthesis 3 (MOCS3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MOCS3 (NM_014484) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95396)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

49.5 kDa

Amino Acid Sequence

MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY

Validation Images & Assay Conditions

Gene/Protein Information For MOCS3 (Source: Uniprot.org, NCBI)

Gene Name

MOCS3

Full Name

Adenylyltransferase and sulfurtransferase MOCS3

Weight

49.5 kDa

Alternative Names

adenylyltransferase and sulfurtransferase MOCS3; dJ914P20.3; molybdenum cofactor synthesis 3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; UBA4, ubiquitin-activating enzyme E1 homolog; UBA4MGC9252; ubiquitin-like modifier activating enzyme 4 MOCS3 UBA4 molybdenum cofactor synthesis 3 adenylyltransferase and sulfurtransferase MOCS3|MPT synthase sulfurylase|UBA4, ubiquitin-activating enzyme E1 homolog|molybdenum cofactor synthesis protein 3|molybdopterin synthase sulfurylase|ubiquitin-like modifier activating enzyme 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MOCS3, check out the MOCS3 Infographic

MOCS3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MOCS3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95396

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MOCS3 (NM_014484) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MOCS3 (NM_014484) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MOCS3 (NM_014484) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95396
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product