MOCS2 (NM_004531) Human Recombinant Protein

MOCS2 protein,

Product Info Summary

SKU: PROTO96007
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MOCS2 (NM_004531) Human Recombinant Protein

View all MOCS2 recombinant proteins

SKU/Catalog Number

PROTO96007

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human molybdenum cofactor synthesis 2 (MOCS2), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MOCS2 (NM_004531) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO96007)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

20.8 kDa

Amino Acid Sequence

MSSLEISSSCFSLETKLPLSPPLVEDSAFEPSRKDMDEVEEKSKDVINFTAEKLSVDEVSQLVISPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEIYEESSTWKGNKECFWASNS

Validation Images & Assay Conditions

Gene/Protein Information For MOCS2 (Source: Uniprot.org, NCBI)

Gene Name

MOCS2

Full Name

Molybdopterin synthase catalytic subunit

Weight

20.8 kDa

Superfamily

MoaE family

Alternative Names

EC 2.-; MCBPE; MOCO1-A; MOCO1-B; MOCO1MOCS2B; MOCS2A; molybdenum cofactor biosynthesis protein E; molybdenum cofactor synthesis 2; Molybdenum cofactor synthesis protein 2 large subunit; Molybdenum cofactor synthesis protein 2 small subunit; Molybdenum cofactor synthesis protein 2A; Molybdenum cofactor synthesis protein 2B; molybdopterin synthase catalytic subunit; molybdopterin synthase sulfur carrier subunit; Molybdopterin-synthase large subunit; Molybdopterin-synthase small subunit; MPT synthase large subunit; MPTS; Sulfur carrier protein MOCS2A MOCS2 MCBPE, MOCO1, MOCODB, MPTS molybdenum cofactor synthesis 2 molybdopterin synthase catalytic subunit|molybdopterin synthase sulfur carrier subunit|molybdenum cofactor biosynthesis protein E

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MOCS2, check out the MOCS2 Infographic

MOCS2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MOCS2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO96007

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MOCS2 (NM_004531) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MOCS2 (NM_004531) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MOCS2 (NM_004531) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO96007
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.