MOBKL2C (MOB3C) (NM_201403) Human Recombinant Protein

Mob3c protein,

Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2C (yeast) (MOBKL2C), transcript variant 2

Product Info Summary

SKU: PROTQ70IA8
Size: 20 µg
Source: HEK293T

Product Name

MOBKL2C (MOB3C) (NM_201403) Human Recombinant Protein

View all Mob3c recombinant proteins

SKU/Catalog Number

PROTQ70IA8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human MOB1, Mps One Binder kinase activator-like 2C (yeast) (MOBKL2C), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MOBKL2C (MOB3C) (NM_201403) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ70IA8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.4 kDa

Amino Acid Sequence

MALCLKQVFAKDKTFRPRKRFEPGTQRFELYKKAQASLKSGLDLRSVVRLPPGENIDDWIAVHVVDFFNRINLIYGTMAERCSETSCPVMAGGPRYEYRWQDERQYRRPAKLSAPRYMALLMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH

Validation Images & Assay Conditions

Gene/Protein Information For MOB3C (Source: Uniprot.org, NCBI)

Gene Name

MOB3C

Full Name

MOB kinase activator 3C

Weight

25.4 kDa

Superfamily

MOB1/phocein family

Alternative Names

MOB kinase activator 3C

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MOB3C, check out the MOB3C Infographic

MOB3C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MOB3C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ70IA8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MOBKL2C (MOB3C) (NM_201403) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MOBKL2C (MOB3C) (NM_201403) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MOBKL2C (MOB3C) (NM_201403) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ70IA8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.