MLX (NM_198205) Human Recombinant Protein

MLX protein,

Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1

Product Info Summary

SKU: PROTQ9UH92
Size: 20 µg
Source: HEK293T

Product Name

MLX (NM_198205) Human Recombinant Protein

View all MLX recombinant proteins

SKU/Catalog Number

PROTQ9UH92

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MLX (NM_198205) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UH92)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.7 kDa

Amino Acid Sequence

MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY

Validation Images & Assay Conditions

Gene/Protein Information For MLX (Source: Uniprot.org, NCBI)

Gene Name

MLX

Full Name

Max-like protein X

Weight

24.7 kDa

Alternative Names

BHLHD13; bHLHd13Max-like bHLHZip protein; BigMax alpha; BigMax protein; Class D basic helix-loop-helix protein 13; MAD7; MAX-like protein X; MLX; MXD7; TCFL4; TCFL4Protein BigMax; transcription factor-like 4; Transcription factor-like protein 4 MLX MAD7, MXD7, TCFL4, TF4, bHLHd13 MAX dimerization protein MLX max-like protein X|BigMax protein|MAX-like bHLHZIP protein|MLX, MAX dimerization protein|class D basic helix-loop-helix protein 13|transcription factor-like protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MLX, check out the MLX Infographic

MLX infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MLX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UH92

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MLX (NM_198205) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MLX (NM_198205) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MLX (NM_198205) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UH92
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.