Midkine (MDK) (NM_002391) Human Recombinant Protein

Midkine protein,

Product Info Summary

SKU: PROTP21741
Size: 20 µg
Source: HEK293T

Product Name

Midkine (MDK) (NM_002391) Human Recombinant Protein

View all Midkine recombinant proteins

SKU/Catalog Number

PROTP21741

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human midkine (neurite growth-promoting factor 2) (MDK), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Midkine (MDK) (NM_002391) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP21741)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.4 kDa

Amino Acid Sequence

MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Validation Images & Assay Conditions

Gene/Protein Information For MDK (Source: Uniprot.org, NCBI)

Gene Name

MDK

Full Name

Midkine

Weight

15.4 kDa

Superfamily

pleiotrophin family

Alternative Names

Amphiregulin-associated protein; ARAP; MDK; MEK; Midgestation and kidney protein; midkine (neurite growth-promoting factor 2); Midkine; MK1; MKARAP; NEGF2; NEGF2FLJ27379; Neurite outgrowth-promoting factor 2; Neurite outgrowth-promoting protein MDK ARAP, MK, NEGF2 midkine midkine|amphiregulin-associated protein|midgestation and kidney protein|neurite growth-promoting factor 2|neurite outgrowth-promoting factor 2|retinoic acid inducible factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MDK, check out the MDK Infographic

MDK infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MDK: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP21741

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Midkine (MDK) (NM_002391) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Midkine (MDK) (NM_002391) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Midkine (MDK) (NM_002391) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP21741
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.