MEK3 (MAP2K3) (NM_145109) Human Recombinant Protein

MKK3/MEK3 protein,

Product Info Summary

SKU: PROTP46734
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MEK3 (MAP2K3) (NM_145109) Human Recombinant Protein

View all MKK3/MEK3 recombinant proteins

SKU/Catalog Number

PROTP46734

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitogen-activated protein kinase kinase 3 (MAP2K3), transcript variant B

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MEK3 (MAP2K3) (NM_145109) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP46734)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.1 kDa

Amino Acid Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Validation Images & Assay Conditions

Gene/Protein Information For MAP2K3 (Source: Uniprot.org, NCBI)

Gene Name

MAP2K3

Full Name

Dual specificity mitogen-activated protein kinase kinase 3

Weight

39.1 kDa

Superfamily

protein kinase superfamily

Alternative Names

MAP kinase kinase 3; MAP2K3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3PRKMK3dual specificity mitogen-activated protein kinase kinase 3; MEK3; MEK3MEK 3; mitogen activated protein kinase kinase 3; mitogen-activated protein kinase kinase 3; MKK3; MKK3EC 2.7.12.2; PRKMK3 MAP2K3 MAPKK3, MEK3, MKK3, PRKMK3, SAPKK-2, SAPKK2 mitogen-activated protein kinase kinase 3 dual specificity mitogen-activated protein kinase kinase 3|MAP kinase kinase 3|MAPK/ERK kinase 3|MAPKK 3|MEK 3|SAPK kinase 2|stress-activated protein kinase kinase 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MAP2K3, check out the MAP2K3 Infographic

MAP2K3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MAP2K3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP46734

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MEK3 (MAP2K3) (NM_145109) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MEK3 (MAP2K3) (NM_145109) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MEK3 (MAP2K3) (NM_145109) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP46734
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.