MCCD1 (NM_001011700) Human Recombinant Protein

MCCD1 protein,

Recombinant protein of human mitochondrial coiled-coil domain 1 (MCCD1), nuclear gene encoding mitochondrial protein

Product Info Summary

SKU: PROTP59942
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MCCD1 (NM_001011700) Human Recombinant Protein

View all MCCD1 recombinant proteins

SKU/Catalog Number

PROTP59942

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human mitochondrial coiled-coil domain 1 (MCCD1), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MCCD1 (NM_001011700) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP59942)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.1 kDa

Amino Acid Sequence

MVLPLPWLSRYHFLRLLLPSWSLAPQGSHGCCSQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQMRRHQESLGGGA

Validation Images & Assay Conditions

Gene/Protein Information For MCCD1 (Source: Uniprot.org, NCBI)

Gene Name

MCCD1

Full Name

Mitochondrial coiled-coil domain protein 1

Weight

13.1 kDa

Alternative Names

Mitochondrial coiled-coil domain protein 1 MCCD1 mitochondrial coiled-coil domain 1 mitochondrial coiled-coil domain protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MCCD1, check out the MCCD1 Infographic

MCCD1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MCCD1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used MCCD1 (NM_001011700) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MCCD1 (NM_001011700) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MCCD1 (NM_001011700) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP59942
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.