MBD3L5 (NM_001136507) Human Recombinant Protein

MBD3L5 protein,

Recombinant protein of human methyl-CpG-binding domain protein 3-like 5-like (MBD3L5)

Product Info Summary

SKU: PROTA6NJ08
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MBD3L5 (NM_001136507) Human Recombinant Protein

View all MBD3L5 recombinant proteins

SKU/Catalog Number

PROTA6NJ08

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human methyl-CpG-binding domain protein 3-like 5-like (MBD3L5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MBD3L5 (NM_001136507) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTA6NJ08)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.8 kDa

Amino Acid Sequence

MGEPAFTSFPSPPVLGKLKRNMMPWALQKKREIHMAKAHRRRAARSALPMRLTSCIFRRPVTRIRSHPDNQVRRRKGDEHLEKPQQLCAYRRLQALQPCSSQGEGSSPLHLESVLSILAPGTAGESLDRAGAERVRIPLEPTPGRFPAVAGGPTPGMGCQLPPPLSGQLVTPADIRRQARRVKKARERLAKALQADRLARQAEMLTGG

Validation Images & Assay Conditions

Gene/Protein Information For MBD3L5 (Source: Uniprot.org, NCBI)

Gene Name

MBD3L5

Full Name

Putative methyl-CpG-binding domain protein 3-like 5

Weight

22.8 kDa

Superfamily

MBD3L family

Alternative Names

Putative methyl-CpG-binding domain protein 3-like 5 MBD3L5 methyl-CpG binding domain protein 3 like 5 putative methyl-CpG-binding domain protein 3-like 5|MBD3-like protein 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MBD3L5, check out the MBD3L5 Infographic

MBD3L5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MBD3L5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTA6NJ08

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MBD3L5 (NM_001136507) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MBD3L5 (NM_001136507) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MBD3L5 (NM_001136507) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTA6NJ08
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.