MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein

MAGP-1/MFAP2 protein,

Product Info Summary

SKU: PROTP55001
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein

View all MAGP-1/MFAP2 recombinant proteins

SKU/Catalog Number

PROTP55001

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55001)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.9 kDa

Amino Acid Sequence

MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC

Validation Images & Assay Conditions

Gene/Protein Information For MFAP2 (Source: Uniprot.org, NCBI)

Gene Name

MFAP2

Full Name

Microfibrillar-associated protein 2

Weight

18.9 kDa

Superfamily

MFAP family

Alternative Names

MAGP1; MAGP-1; MAGP-1FLJ50901; MAGPMFAP-2; MFAP2; Microfibril-associated glycoprotein 1; microfibrillar-associated protein 2 MFAP2 MAGP, MAGP-1, MAGP1 microfibril associated protein 2 microfibrillar-associated protein 2|microfibril-associated glycoprotein 1|microfibrillar associated protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MFAP2, check out the MFAP2 Infographic

MFAP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MFAP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55001

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55001
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.