Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Recombinant Protein

CCL15/MIP-1 delta protein,

Product Info Summary

SKU: PROTQ16663
Size: 20 µg
Source: HEK293T

Product Name

Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Recombinant Protein

View all CCL15/MIP-1 delta recombinant proteins

SKU/Catalog Number

PROTQ16663

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ16663)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0127kDa

Amino Acid Sequence

MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Validation Images & Assay Conditions

Gene/Protein Information For CCL15 (Source: Uniprot.org, NCBI)

Gene Name

CCL15

Full Name

C-C motif chemokine 15

Weight

0.0127kDa

Superfamily

intercrine beta (chemokine CC) family

Alternative Names

CCL15; chemokine (C-C motif) ligand 15; Chemokine CC-2; HCC-2; HCC-2Lkn-1; Leukotactin 1; Leukotactin-1; LKN1; LKN-1; Macrophage inflammatory protein 5; MIP1 delta; MIP-1 delta; MIP5; MIP-5; MIP-5MIP-1d; Mrp-2b; NCC-3; NCC-3MIP-1D; NCC3MRP-2B; new CC chemokine 3; SCYA15member 15; Small-inducible cytokine A15 CCL15 HCC-2, HMRP-2B, LKN-1, LKN1, MIP-1 delta, MIP-1D, MIP-5, MRP-2B, NCC-3, NCC3, SCYA15, SCYL3, SY15 C-C motif chemokine ligand 15 C-C motif chemokine 15|chemokine (C-C motif) ligand 15|chemokine CC-2|leukotactin 1|macrophage inflammatory protein 5|new CC chemokine 3|small inducible cytokine subfamily A (Cys-Cys), member 15|small-inducible cytokine A15

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CCL15, check out the CCL15 Infographic

CCL15 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CCL15: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ16663

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Macrophage inflammatory protein 5 (CCL15) (NM_032964) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ16663
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.