LYRM2 (NM_020466) Human Recombinant Protein

LYRM2 protein,

Recombinant protein of human LYR motif containing 2 (LYRM2)

Product Info Summary

SKU: PROTQ9NU23
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LYRM2 (NM_020466) Human Recombinant Protein

View all LYRM2 recombinant proteins

SKU/Catalog Number

PROTQ9NU23

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human LYR motif containing 2 (LYRM2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LYRM2 (NM_020466) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NU23)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

10.3 kDa

Amino Acid Sequence

MAASRLPPATLTLKQFVRRQQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMITQGNMQLKELEKTLALAKS

Validation Images & Assay Conditions

Gene/Protein Information For LYRM2 (Source: Uniprot.org, NCBI)

Gene Name

LYRM2

Full Name

LYR motif-containing protein 2

Weight

10.3 kDa

Superfamily

complex I LYR family

Alternative Names

DJ122O8.2; FLJ18193; FLJ18317; FLJ21130; LYR motif containing 2; LYR motif-containing protein 2; MGC104253 LYRM2 DJ122O8.2 LYR motif containing 2 LYR motif-containing protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LYRM2, check out the LYRM2 Infographic

LYRM2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LYRM2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NU23

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LYRM2 (NM_020466) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LYRM2 (NM_020466) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LYRM2 (NM_020466) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NU23
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.