LXN (NM_020169) Human Recombinant Protein

Latexin protein,

Product Info Summary

SKU: PROTQ9BS40
Size: 20 µg
Source: HEK293T

Product Name

LXN (NM_020169) Human Recombinant Protein

View all Latexin recombinant proteins

SKU/Catalog Number

PROTQ9BS40

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human latexin (LXN)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LXN (NM_020169) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BS40)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.6 kDa

Amino Acid Sequence

MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Validation Images & Assay Conditions

Gene/Protein Information For LXN (Source: Uniprot.org, NCBI)

Gene Name

LXN

Full Name

Latexin

Weight

25.6 kDa

Superfamily

protease inhibitor I47 (latexin) family

Alternative Names

ECI; ECIMUM; Endogenous carboxypeptidase inhibitor; Latexin; LXN; TCI; TCIProtein MUM; Tissue carboxypeptidase inhibitor Lxn|latexin|latexin|ECI|TCI|endogenous carboxypeptidase inhibitor|tissue carboxypeptidase inhibitor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LXN, check out the LXN Infographic

LXN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LXN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BS40

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LXN (NM_020169) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LXN (NM_020169) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LXN (NM_020169) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BS40
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.