LSAMP (NM_002338) Human Recombinant Protein

LAMP protein,

Recombinant protein of human limbic system-associated membrane protein (LSAMP)

Product Info Summary

SKU: PROTQ13449
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LSAMP (NM_002338) Human Recombinant Protein

View all LAMP recombinant proteins

SKU/Catalog Number

PROTQ13449

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human limbic system-associated membrane protein (LSAMP)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LSAMP (NM_002338) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13449)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.1 kDa

Amino Acid Sequence

MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC

Validation Images & Assay Conditions

Gene/Protein Information For LSAMP (Source: Uniprot.org, NCBI)

Gene Name

LSAMP

Full Name

Limbic system-associated membrane protein

Weight

34.1 kDa

Superfamily

immunoglobulin superfamily

Alternative Names

FLJ34254; FLJ35396; IgLON family member 3; IGLON3FLJ54658; LAMP; LAMPFLJ37216; limbic system-associated membrane protein; LSAMP LSAMP IGLON3, LAMP limbic system associated membrane protein limbic system-associated membrane protein|IgLON family member 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LSAMP, check out the LSAMP Infographic

LSAMP infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LSAMP: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13449

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LSAMP (NM_002338) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LSAMP (NM_002338) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LSAMP (NM_002338) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13449
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product