LIN52 (NM_001024674) Human Recombinant Protein

LIN52 protein,

Recombinant protein of human lin-52 homolog (C. elegans) (LIN52)

Product Info Summary

SKU: PROTQ52LA3
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

LIN52 (NM_001024674) Human Recombinant Protein

View all LIN52 recombinant proteins

SKU/Catalog Number

PROTQ52LA3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human lin-52 homolog (C. elegans) (LIN52)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

LIN52 (NM_001024674) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ52LA3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.8 kDa

Amino Acid Sequence

MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKK

Validation Images & Assay Conditions

Gene/Protein Information For LIN52 (Source: Uniprot.org, NCBI)

Gene Name

LIN52

Full Name

Protein lin-52 homolog

Weight

12.8 kDa

Superfamily

lin-52 family

Alternative Names

c14_5549; C14orf46; chromosome 14 open reading frame 46; lin-52 homolog (C. elegans); protein lin-52 homolog LIN52 C14orf46, c14_5549 lin-52 DREAM MuvB core complex component protein lin-52 homolog|lin-52 homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on LIN52, check out the LIN52 Infographic

LIN52 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for LIN52: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ52LA3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used LIN52 (NM_001024674) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For LIN52 (NM_001024674) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for LIN52 (NM_001024674) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ52LA3
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.