KIAA1191 (NM_001079685) Human Recombinant Protein

p33MONOX protein,

Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 3

Product Info Summary

SKU: PROTQ96A73
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

KIAA1191 (NM_001079685) Human Recombinant Protein

View all p33MONOX recombinant proteins

SKU/Catalog Number

PROTQ96A73

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human KIAA1191 (KIAA1191), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KIAA1191 (NM_001079685) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96A73)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

33.1 kDa

Amino Acid Sequence

MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGF

Validation Images & Assay Conditions

Gene/Protein Information For KIAA1191 (Source: Uniprot.org, NCBI)

Gene Name

KIAA1191

Full Name

Putative monooxygenase p33MONOX

Weight

33.1 kDa

Superfamily

P33MONOX family

Alternative Names

Brain-derived rescue factor p60MONOX; FLJ21022; hypothetical protein LOC57179; KIAA1191; p60MONOX KIAA1191 p33MONOX, p60MONOX KIAA1191 putative monooxygenase p33MONOX|brain-derived rescue factor p60MONOX|flavin monooxygenase motif-containing protein of 33 kDa|flavine monooxygenase motif-containing protein of 33 kDa|p60MONOX brain-derived rescue factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KIAA1191, check out the KIAA1191 Infographic

KIAA1191 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KIAA1191: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96A73

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KIAA1191 (NM_001079685) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KIAA1191 (NM_001079685) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KIAA1191 (NM_001079685) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96A73
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product