JM4 (PRAF2) (NM_007213) Human Recombinant Protein

PRAF2 protein,

Recombinant protein of human PRA1 domain family, member 2 (PRAF2)

Product Info Summary

SKU: PROTO60831
Size: 20 µg
Source: HEK293T

Product Name

JM4 (PRAF2) (NM_007213) Human Recombinant Protein

View all PRAF2 recombinant proteins

SKU/Catalog Number

PROTO60831

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PRA1 domain family, member 2 (PRAF2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

JM4 (PRAF2) (NM_007213) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60831)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

19.1 kDa

Amino Acid Sequence

MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS

Validation Images & Assay Conditions

Gene/Protein Information For PRAF2 (Source: Uniprot.org, NCBI)

Gene Name

PRAF2

Full Name

PRA1 family protein 2

Weight

19.1 kDa

Superfamily

PRA1 family

Alternative Names

PRA1 family protein 2 PRAF2 JM4, Yip6a PRA1 domain family member 2 PRA1 family protein 2|Jena-Muenchen 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PRAF2, check out the PRAF2 Infographic

PRAF2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PRAF2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60831

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used JM4 (PRAF2) (NM_007213) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For JM4 (PRAF2) (NM_007213) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for JM4 (PRAF2) (NM_007213) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60831
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product